PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G2229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 261aa    MW: 30586.5 Da    PI: 9.3233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G2229genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.87e-202168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll+++vk++G g+W+++a+  g++R +k+c++rw +yl
      Gh_D09G2229 21 KGPWTAEEDKLLIEYVKLHGEGRWNSVAKLAGLKRNGKSCRLRWVNYL 68
                     79********************************************97 PP

2Myb_DNA-binding51.81.8e-1674118147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
      Gh_D09G2229  74 RGQITPHEESIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 118
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1011672IPR017930Myb domain
SuperFamilySSF466896.83E-3119115IPR009057Homeodomain-like
SMARTSM007172.2E-172070IPR001005SANT/Myb domain
PfamPF002498.7E-192168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-242275IPR009057Homeodomain-like
CDDcd001671.55E-122368No hitNo description
PROSITE profilePS5129418.16173123IPR017930Myb domain
SMARTSM007171.4E-1473121IPR001005SANT/Myb domain
PfamPF002491.1E-1374118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-2476122IPR009057Homeodomain-like
CDDcd001677.73E-1078119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSWALMARHF GWGIMEESWR KGPWTAEEDK LLIEYVKLHG EGRWNSVAKL AGLKRNGKSC  60
RLRWVNYLRP DLKRGQITPH EESIILELHA RWGNRWSTIA RSLPGRTDNE IKNYWRTHFK  120
KKPDNSIKAK ARILKRQQFQ QQQILQQQQQ QYQQQQNQLD MKRIMSLLDE TEHKVPYVPQ  180
MSRQETMGTT NSYLNHNNTT DQEQGFVYPM IIDGNVSSSD TSNEEFLWDG LWNLDDDFNG  240
NFSAACATSK ASLHNLATPF C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-282112227127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487368.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A0D2NYF50.0A0A0D2NYF5_G
STRINGPOPTR_0008s17350.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.17e-90myb domain protein 305